Analytical Data
-
Gene name
SLC39A1
- Application
-
Alternative Names
SLC39A1;IRT1;ZIP1;ZIRTL;Zinc transporter ZIP1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NY26
-
Expression Region
126-179aa
-
AA Sequence
MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
-
Molecular Weight
33.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC39A1, also known as ZIP1, is a member of the SLC39 family of metal ion transporters, which play a crucial role in the uptake of essential trace metals, including zinc. Zinc is vital for numerous biological processes, including enzyme function, gene expression, and cellular signaling. Aberrant regulation of SLC39A1 has been implicated in various diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target and biomarker. Research into recombinant SLC39A1 protein aims to elucidate its structure-function relationships, metal binding properties, and regulatory mechanisms. By producing this protein in a recombinant system, scientists can investigate its transport activity, interaction with other proteins, and role in cellular homeostasis under different physiological conditions. Understanding SLC39A1's mechanisms can pave the way for novel therapeutic interventions in diseases linked to metal ion dysregulation. Thus, the study of recombinant SLC39A1 is not only critical for basic science but also holds promise for advancing clinical applications.











