Analytical Data
-
Gene name
EIF4EBP2
- Application
-
Alternative Names
EIF4EBP2;Eukaryotic translation initiation factor 4E-binding Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13542
-
Expression Region
1-120aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQL PHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPG VTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF4EBP2, a member of the eukaryotic translation initiation factor 4E binding proteins (4E-BPs), plays a crucial role in the regulation of protein synthesis in response to various cellular signals, particularly in the context of mTOR signaling pathway. This protein acts as a translational repressor by binding to the cap-binding protein eIF4E, thereby preventing the formation of the eIF4F complex necessary for mRNA translation. Dysregulation of EIF4EBP2 has been implicated in various diseases, including cancer, where altered protein synthesis contributes to uncontrolled cell growth and proliferation. Researchers have increasingly focused on the potential of EIF4EBP2 as a therapeutic target, as modulating its activity could directly influence tumorigenesis and metabolic regulation. The study of recombinant EIF4EBP2 has facilitated the exploration of its structural properties, interaction dynamics with eIF4E, and downstream effects on global protein synthesis. By employing techniques such as crystallography, mutagenesis, and in vitro translation assays, scientists aim to uncover the molecular mechanisms underlying its function and develop innovative strategies for targeting its pathway in disease contexts. Understanding the intricate balance that EIF4EBP2 maintains in translation regulation is vital, as it not only sheds light on fundamental biological processes but also opens avenues for novel cancer therapies, thereby emphasizing its significance in both basic and applied biomedical research.
