Analytical Data
-
Gene name
yscF
- Application
-
Alternative Names
yscF；yscF；Type 3 secretion system needle filament Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01247
-
Expression Region
1-87aa
-
AA Sequence
MSNFSGFTKGNDIADLDAVAQTLKKPADDANKAVNDSIAALKDTPDNPALLADLQHSINKWSVIYNISSTIVRSMKDLMQGILQKFP
-
Molecular Weight
9.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The yscF gene, part of the type III secretion system (T3SS) in various pathogens, plays a critical role in the virulence and pathogenicity of several bacteria. This gene encodes a small protein that is believed to be involved in the assembly and stability of the T3SS structure, which is crucial for the translocation of effector proteins into host cells. Understanding yscF and its encoded protein is vital for dissecting the mechanisms of bacterial infection and the host-pathogen interaction. Several studies have highlighted that manipulating or targeting yscF can influence the pathogenicity of bacteria, making it a potential candidate for developing novel therapeutic strategies. Research focusing on the recombinant form of yscF protein aims to elucidate its function, structural properties, and interactions within the T3SS. Additionally, recombinant yscF protein can serve as a valuable tool for generating antibodies and understanding the immune response elicited during infection. Investigating yscF protein not only enhances our understanding of bacterial virulence mechanisms but also contributes to the broader field of microbiology and infectious disease research. The potential to develop vaccines or inhibitors targeting yscF offers promising avenues for combating bacterial infections that rely on T3SS for their pathogenic effects.
