Cat: PA2000-3795

Recombinant E.coli PNTx4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PNTx4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PNTx4;

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P59368

  • Expression Region

    35-82aa

  • AA Sequence

    CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

  • Molecular Weight

    7.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PNTx4, a recombinant protein derived from the venom of the Brazilian pit viper, has garnered significant attention in scientific research due to its potential therapeutic applications. Its unique structure and mechanism of action highlight its role as a potent inhibitor of specific ion channels, which are crucial for various physiological processes. The study of PNTx4 is driven by the increasing need for novel approaches in managing pain, as traditional analgesics often come with limitations and side effects. Preliminary research suggests that PNTx4 may modulate pain pathways effectively while minimizing adverse reactions, making it a promising candidate for pain relief therapies. Furthermore, as an example of bioprospecting in the field of pharmacology, investigating PNTx4 can contribute to the discovery of new drug leads derived from natural sources. Understanding the molecular interactions and biological mechanisms of PNTx4 not only elucidates its functional properties but also opens avenues for rational drug design and development. Overall, the research on PNTx4 exemplifies the intersection of toxin biology and therapeutic innovation, showcasing how naturally occurring molecules can inspire new strategies for treating complex medical conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US