Analytical Data
-
Gene name
PNTx4
- Application
-
Alternative Names
PNTx4；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59368
-
Expression Region
35-82aa
-
AA Sequence
CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC
-
Molecular Weight
7.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PNTx4, a recombinant protein derived from the venom of the Brazilian pit viper, has garnered significant attention in scientific research due to its potential therapeutic applications. Its unique structure and mechanism of action highlight its role as a potent inhibitor of specific ion channels, which are crucial for various physiological processes. The study of PNTx4 is driven by the increasing need for novel approaches in managing pain, as traditional analgesics often come with limitations and side effects. Preliminary research suggests that PNTx4 may modulate pain pathways effectively while minimizing adverse reactions, making it a promising candidate for pain relief therapies. Furthermore, as an example of bioprospecting in the field of pharmacology, investigating PNTx4 can contribute to the discovery of new drug leads derived from natural sources. Understanding the molecular interactions and biological mechanisms of PNTx4 not only elucidates its functional properties but also opens avenues for rational drug design and development. Overall, the research on PNTx4 exemplifies the intersection of toxin biology and therapeutic innovation, showcasing how naturally occurring molecules can inspire new strategies for treating complex medical conditions.
