Analytical Data
-
Gene name
KIAA1377
- Application
-
Alternative Names
KIAA1377；KIAA1377；Centrosomal Protein of 126 kDa
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P2H0
-
Expression Region
559-670aa
-
AA Sequence
HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG
-
Molecular Weight
28.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA1377 is a gene that encodes a protein whose function is not yet fully understood, but it has gained attention in the field of molecular biology due to its potential implications in various cellular processes. Research on KIAA1377 has emerged from its association with several physiological pathways and its possible involvement in diseases, particularly cancer. Studies suggest that KIAA1377 might play a role in cell proliferation, differentiation, and apoptosis, making it a candidate for exploration in the context of tumorigenesis. Furthermore, its expression levels can vary in different tissues and under various pathological conditions, which adds to its intrigue as a biomarker and therapeutic target. Recent advancements in proteomic and genomic techniques have facilitated the study of KIAA1377’s protein structure and interactions, revealing potential pathways it might influence. Understanding the functional mechanisms of KIAA1377 could provide insights into cancer biology and lead to the development of novel diagnostic and therapeutic strategies. As such, ongoing research aims to elucidate the full spectrum of KIAA1377's roles within the cellular environment, promising to enhance our understanding of complex diseases and potentially uncover new avenues for treatment.
