Analytical Data
-
Gene name
GPR1
- Application
-
Alternative Names
CMKLR2; GPR1; Chemerin-like receptor 2; Chemerin chemokine-like receptor 2; Chemokine-like receptor 2; G-protein coupled receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46091
-
Expression Region
1-355aa
-
AA Sequence
MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
-
Molecular Weight
41.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR1, a G protein-coupled receptor (GPCR), has garnered significant interest in the field of molecular biology and pharmacology due to its potential roles in various physiological processes. Initially identified in yeast as a regulatory protein involved in nutrient sensing and stress response, it has since been shown to exhibit similar functions in higher organisms, including humans. Research indicates that GPR1 may play critical roles in mediating cellular responses to different stimuli, potentially influencing metabolic pathways and hormonal signaling. The importance of GPR1 is further underscored by its involvement in several health conditions, including obesity, diabetes, and cardiovascular diseases. Thus, understanding the structure and function of GPR1, particularly through the study of its recombinant protein, is crucial for elucidating its mechanisms of action and exploring its therapeutic potential. Recombinant GPR1 can be used for various applications, including drug screening, functional assays, and structural studies, aiming to identify novel ligands that could modulate its activity. As the field advances, the investigation of GPR1 is expected to contribute significantly to the discovery of new therapeutic strategies targeting metabolic disorders and other related diseases.
