Cat: PA2000-3885

Recombinant E.coli mscL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    mscL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    mscL;Scl;Selenocysteine lyase

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A743

  • Expression Region

    1-136aa

  • AA Sequence

    MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS

  • Molecular Weight

    29.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MscL (Mechanosensitive Channel of Large Conductance) is a vital protein that plays a crucial role in bacterial osmoregulation by providing a pathway for ions and small molecules to traverse the cell membrane in response to mechanical stress. Understanding MscL is essential due to its implications in cellular stress responses and its potential as a target for antibiotic development. The protein itself is a homopentameric channel that opens under high tension, allowing for the rapid release of solutes to prevent cellular lysis. Research on MscL has advanced significantly with the advent of recombinant protein technology, enabling the production of large quantities of purified MscL for structural and functional studies. Methods such as X-ray crystallography and cryo-electron microscopy have yielded insights into its structural conformation and gating mechanism. These studies not only illuminate the fundamental principles of mechanosensation in bacteria but also pave the way for biotechnological applications. The ability to incorporate MscL into synthetic membranes or study its interactions with various lipid environments enhances our understanding of membrane biology and could lead to innovative approaches in biomimetic materials. Furthermore, the investigation of MscL's channel properties, ion selectivity, and its response to mechanical stimuli remains a vibrant area of research with implications in fields ranging from microbiology to biophysics and pharmaceuticals. Overall, the exploration of recombinant MscL is pivotal for unraveling the complexities of mechanotransduction and facilitating advances in bioscience.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US