Cat: PA1000-1094

Recombinant Human FBLIM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FBLIM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FBLIM1;FBLP1;Filamin-binding LIM Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WUP2

  • Expression Region

    1-373aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMASKPEKRVASSVFITLAPPRRDVAVA EEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAP MQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGA SLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKG ASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKD GRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIG DESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRN FHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FBLIM1, or F-actin binding LIM protein 1, is a multi-functional protein primarily known for its role in cell adhesion, migration, and signal transduction. It is characterized by its LIM domains, which facilitate protein-protein interactions and link cytoskeletal elements to cell signaling pathways. Research has increasingly focused on the role of FBLIM1 in various cellular processes, including its implications in cancer progression, fibrosis, and muscle differentiation. Alterations in FBLIM1 expression and function have been associated with several pathological conditions, suggesting its potential as a biomarker or therapeutic target. Investigating the structure and function of recombinant FBLIM1 protein is crucial for understanding its specific molecular mechanisms. The recombinant protein can be used to elucidate the interactions with other cellular components, assess its role in actin organization, and explore its involvement in disease states. By employing techniques such as co-immunoprecipitation and cell-based assays, researchers aim to clarify the contributions of FBLIM1 to cellular dynamics and its potential regulation by extracellular stimuli. The insights gained from studying FBLIM1 not only enrich our understanding of cellular biology but also pave the way for the development of novel interventions in diseases characterized by dysregulated cellular behavior.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US