Analytical Data
-
Gene name
GUCA1C
- Application
-
Alternative Names
GCAP 3; Guanylate cyclase activating photoreceptor 3; Guanylate cyclase activator 1C; Guanylyl cyclase activating protein 3; Guanylyl cyclase-activating protein 3; GUC1C_HUMAN; GUCA1C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95843
-
Expression Region
1-209aa
-
AA Sequence
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCA1C, a member of the guanylate cyclase-activating protein family, is primarily expressed in retinal photoreceptor cells and plays a critical role in the phototransduction cascade. Mutations in the GUCA1C gene have been linked to various retinal diseases, including autosomal dominant retinitis pigmentosa and cone-rod dystrophy, leading to progressive vision loss. Understanding the functional dynamics of GUCA1C is essential, as it regulates the activity of guanylate cyclase, which is pivotal for restoring the concentration of cyclic GMP in photoreceptor cells after light exposure. To elucidate its mechanisms and interactions, researchers often focus on the production and characterization of recombinant GUCA1C proteins. Recombinant proteins enable the investigation of biochemical properties, interaction studies, and potential therapeutic applications for retinal disorders. By analyzing these proteins, scientists aim to uncover the molecular basis of GUCA1C-related diseases, paving the way for innovative treatment strategies to mitigate vision loss associated with genetic mutations in GUCA1C. This research is not only vital for a deeper understanding of retinal biology but also has implications for gene therapy approaches targeting specific retinal conditions linked to GUCA1C.
