Cat: PA2000-1DB

Recombinant Human HTRA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HTRA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HTRA1;HTRA;PRSS11;Serine protease HTRA1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92743

  • Expression Region

    23-480aa

  • AA Sequence

    QLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPE GAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSD ANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFI ADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVV TNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSE LRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAI INYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQA KGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTP AEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMIT VIPEEIDP

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HTRA1 (High-temperature requirement A serine peptidase 1) is a serine protease that has garnered significant attention in biomedical research due to its involvement in various pathological processes, particularly in age-related diseases such as age-related macular degeneration (AMD). This extracellular enzyme is known to play a crucial role in the regulation of cellular processes, including protein quality control, apoptosis, and extracellular matrix remodeling. Abnormal HTRA1 expression has been linked to increased susceptibility to AMD, making it a potential biomarker and therapeutic target for this vision-threatening condition. Additionally, HTRA1 is involved in neurodegenerative diseases and certain cancers, further underscoring its importance in human health. The recombinant form of HTRA1 is particularly useful for detailed biochemical and structural studies, allowing researchers to dissect its functional mechanisms, enzyme activity, and interaction with substrates and inhibitors. The production of HTRA1 recombinant protein enables high-throughput screening and the development of novel therapeutic strategies, including small molecules or monoclonal antibodies that target the dysregulated pathways associated with its aberrant expression. Overall, HTRA1 recombinant protein research highlights its significance not only in understanding fundamental biological processes but also in identifying innovative approaches to disease treatment and prevention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US