Cat: PA1000-1285

Recombinant Human GNAI3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GNAI3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GNAI3;Guanine nucleotide-binding Protein G(i) subunit alpha-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08754

  • Expression Region

    2-354aa

  • AA Sequence

    GCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVK QMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARA DDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDS ASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDV GGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFD SICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAA YIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKEC GLY

  • Molecular Weight

    42.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GNAI3, a member of the G protein alpha subunit family, plays a critical role in various cellular signaling pathways by regulating the activity of downstream effectors in response to G protein-coupled receptor activation. Recent studies have highlighted its involvement in diverse physiological processes such as cell proliferation, differentiation, and metabolism, as well as in pathological conditions including cancer, neurodegenerative diseases, and cardiovascular disorders. The functional dysregulation of GNAI3 has been implicated in tumorigenesis, leading to increasing interest in its potential as a therapeutic target. Furthermore, the development of recombinant GNAI3 proteins has facilitated in-depth investigations of its biochemical properties, interaction dynamics, and functional consequences in cellular contexts. By employing advanced techniques such as site-directed mutagenesis, biophysical characterization, and interaction assays, researchers aim to elucidate the mechanisms by which GNAI3 mediates signal transduction. This research not only contributes to a better understanding of GNAI3's role in health and disease but also paves the way for the identification of novel therapeutic strategies aimed at modulating GNAI3 activity for therapeutic benefit.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US