Analytical Data
-
Gene name
ADPN
- Application
-
Alternative Names
ADPN；ADPN；C22orf20；1-acylglycerol-3-phosphate O-acyltransferase PNPLA3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NST1
-
Expression Region
63-481aa
-
AA Sequence
EQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL
-
Molecular Weight
53.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Adenosine diphosphate-ribosylation factor (ADPR) is a key player in various cellular processes, including vesicular transport, cell signaling, and cytoskeletal dynamics. The study of ADPR recombinant proteins has gained significant attention due to their potential implications in understanding cellular mechanisms and developing novel therapeutic strategies. Research indicates that ADPR proteins are involved in the regulation of intracellular signaling pathways, particularly those related to immune responses and neurodegenerative diseases. By producing recombinant ADPR proteins in model systems, researchers can investigate their structure-function relationships, explore their interactions with other cellular molecules, and elucidate their role in pathological conditions. Furthermore, ADPR proteins also serve as valuable tools in biotechnology and drug development, where their unique properties can be harnessed for targeted therapies. As a result, the ongoing research into ADPR recombinant proteins not only contributes to our fundamental understanding of cellular biology but also opens avenues for innovative therapeutic interventions in various diseases.
