Cat: PA2000-8358

Recombinant Human HS3ST2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HS3ST2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HS3ST2; 3OST2; UNQ2442/PRO5004Heparan sulfate glucosamine 3-O-sulfotransferase 2; EC 2.8.2.29; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2; 3-OST-2; Heparan sulfate 3-O-sulfotransferase 2; h3-OST-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y278

  • Expression Region

    1-367aa

  • AA Sequence

    MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE

  • Molecular Weight

    41.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HS3ST2 (heparan sulfate 3-O-sulfotransferase 2) is an important enzyme involved in the biosynthesis of heparan sulfate, a polysaccharide that plays critical roles in various biological processes, including cell signaling, development, and tissue homeostasis. Research has shown that HS3ST2 is responsible for the specific sulfation of heparan sulfate chains, which modulates their interaction with a wide range of growth factors, cytokines, and extracellular matrix components. This enzymatic activity is particularly significant in regulating key signaling pathways, such as those involving fibroblast growth factor (FGF) and hepatocyte growth factor (HGF), which are essential for processes like angiogenesis and cell proliferation. Dysregulation of HS3ST2 has been implicated in various pathological conditions, including cancer, where altered heparan sulfate sulfation patterns can affect tumor growth and metastasis. Recent studies have focused on the recombinant production and characterization of HS3ST2 to better understand its functional roles and potential as a therapeutic target. By producing HS3ST2 as a recombinant protein, researchers aim to investigate its structural properties, enzymatic activity, and interactions with heparan sulfate substrates, paving the way for innovative approaches to manipulate heparan sulfate biology in disease contexts. This research not only enhances our understanding of HS3ST2's function but also opens avenues for the development of novel strategies in regenerative medicine and cancer therapy, underscoring the importance of this enzyme in both health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US