Analytical Data
-
Gene name
CASP1
- Application
-
Alternative Names
CASP1；IL1BC；IL1BCE；Caspase-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29466
-
Expression Region
1-91aa
-
AA Sequence
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA
-
Molecular Weight
11.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caspase-1 (CASP1) is a crucial protease that plays a significant role in the inflammatory response and the regulation of apoptosis, primarily through the activation of pro-inflammatory cytokines such as interleukin-1β and interleukin-18. Research on CASP1 has gained momentum due to its involvement in various pathological conditions, including autoinflammatory diseases, neurodegenerative disorders, and cancer. The understanding of CASP1's functional mechanisms is essential for developing targeted therapeutics aimed at modulating inflammation and cell death. Recombinant CASP1 proteins have become valuable tools in research, allowing scientists to study its enzymatic activity, interaction with substrates, and regulatory mechanisms in a controlled environment. Furthermore, the production of CASP1 in recombinant systems facilitates high-yield generation for biochemical assays, structural studies, and the development of small molecule inhibitors. Recent advancements in techniques such as CRISPR/Cas9 have also opened new avenues for examining the role of CASP1 in vivo, enhancing our understanding of its biological significance. Given the critical functions of CASP1 in mediating inflammation and cell survival, ongoing research into its recombinant form is pivotal for unraveling the complexities of immune responses and for the potential development of novel clinical strategies in treating diseases associated with dysregulated CASP1 activity.
