Analytical Data
-
Gene name
HYAL3
- Application
-
Alternative Names
Hyal-3; HYAL3; HYAL3_HUMAN; Hyaluronidase 3; Hyaluronidase-3; Hyaluronoglucosaminidase 3; Hyaluronoglucosaminidase-3; LUCA-3; LUCA14 ; LUCA3 ; Lung carcinoma protein 3; Minna14
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43820
-
Expression Region
1-417aa
-
AA Sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
-
Molecular Weight
71.61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HYAL3, a member of the hyaluronidase family, is a recombinant protein that has gained attention in biomedical research due to its unique enzymatic properties and potential therapeutic applications. Hyaluronidases are enzymes that degrade hyaluronic acid, a vital component of the extracellular matrix, which plays a crucial role in various physiological processes such as tissue hydration, cell migration, and wound healing. Understanding the function of HYAL3 is particularly important as it is implicated in several pathological conditions, including tumor progression and inflammation. Research has shown that HYAL3 may influence tumor microenvironments by modulating the degradation of hyaluronic acid, thus affecting tumor cell behavior and immune response. Additionally, the recombinant production of HYAL3 allows for detailed studies of its enzymatic activity, structure, and interactions with other biomolecules, paving the way for potential therapeutic interventions. By elucidating its mechanisms, HYAL3 research could contribute to the development of novel strategies for managing diseases where hyaluronic acid metabolism is disrupted, such as cancer and chronic inflammatory disorders. Overall, the exploration of HYAL3 not only expands our understanding of hyaluronidases but also opens new avenues for the application of this recombinant protein in regenerative medicine and targeted therapies.
