Analytical Data
-
Gene name
GSN
- Application
-
Alternative Names
GSN；Gelsolin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06396
-
Expression Region
514-782aa
-
AA Sequence
DEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
-
Molecular Weight
33.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of GSN (Gelsolin) recombinant proteins is rooted in the understanding of their crucial role in cellular processes, particularly in actin cytoskeleton dynamics. Gelsolin is an actin-binding protein that regulates the assembly and disassembly of actin filaments, which is vital for various cellular functions such as motility, shape maintenance, and intracellular transport. Abnormalities in gelsolin function have been linked to several diseases, including cancer, neurodegenerative disorders, and inflammatory conditions. Consequently, the recombinant expression of GSN provides a valuable tool for investigating its structure-function relationships and interactions with actin and other cellular components. By producing GSN in a controlled laboratory setting, researchers can perform in-depth studies, enabling the elucidation of its regulatory mechanisms and potential therapeutic applications. This research not only enhances our fundamental understanding of cell biology but also opens avenues for developing interventions targeting gelsolin-related pathologies.
