Analytical Data
-
Gene name
ybiS
- Application
-
Alternative Names
ybiS；Probable L.D-transpeptidase YbiS
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AAX9
-
Expression Region
25-306aa
-
AA Sequence
VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSGMPVRLN
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YbiS is a protein of significant interest in the field of microbiology and biochemistry, primarily due to its involvement in bacterial metabolic pathways and potential applications in biotechnology. It was initially identified in Escherichia coli, where it is thought to play a role in the regulation of stress responses and metabolic adaptation. Research has shown that YbiS has similarities to proteins involved in the synthesis and degradation of metabolites, suggesting it may participate in key biochemical processes. The study of YbiS recombinant protein has gained traction as scientists aim to elucidate its structure-function relationship and regulatory mechanisms. Understanding YbiS not only provides insights into bacterial physiology but also opens avenues for novel applications in synthetic biology, such as the engineering of microbial strains for optimized production of valuable compounds. Furthermore, the investigation of YbiS can contribute to our broader understanding of microbial interactions and resilience, particularly in environments where bacteria face various stresses. Given its potential implications, the research on YbiS recombinant protein is poised to enhance our knowledge of microbial systems and facilitate innovative solutions in biotechnology and environmental applications.
