Analytical Data
-
Gene name
CDK5R1
- Application
-
Alternative Names
CDK5R1；GRF2；Ras-specific guanine nucleotide-releasing factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15078
-
Expression Region
99-307aa
-
AA Sequence
AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
-
Molecular Weight
27.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDK5R1, also known as cyclin-dependent kinase 5 regulatory subunit 1 or p35, is a crucial protein that regulates the activity of cyclin-dependent kinase 5 (CDK5), which is involved in various cellular processes, including neuronal development, survival, and synaptic function. CDK5 is unique among cyclin-dependent kinases, as it is predominantly expressed in the nervous system and is activated by its regulatory subunits, such as p35 and its cleavage product, p25. Dysregulation of CDK5 activity has been implicated in multiple neurodegenerative diseases, including Alzheimer's disease, where abnormal activation of CDK5 can lead to neurofibrillary tangles and neuronal death. Research into the recombinant expression of CDK5R1 aims to elucidate its structural and functional properties, allowing for a deeper understanding of its role in neurobiology and its potential as a therapeutic target. By generating and studying recombinant CDK5R1 proteins, scientists can investigate the mechanisms through which CDK5 activity is modulated in health and disease, paving the way for novel interventions in neurodegenerative disorders arising from CDK5 dysregulation. Additionally, the recombinant protein can aid in the development of assay systems to screen for small molecules that could inhibit or enhance CDK5 activity, potentially leading to new treatments for conditions associated with impaired neuronal function. Thus, understanding CDK5R1 through recombinant protein studies is pivotal for advancing our knowledge of neural signaling pathways and developing strategies to combat neurodegenerative diseases.
