Analytical Data
-
Gene name
INO80E
- Application
-
Alternative Names
INO80E; CCDC95; INO80 complex subunit E; Coiled-coil domain-containing protein 95
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NBZ0
-
Expression Region
1-244aa
-
AA Sequence
MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE
-
Molecular Weight
52.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INO80E is a critical component of the INO80 chromatin remodeling complex, which plays an essential role in regulating gene expression, DNA repair, and DNA replication in eukaryotic cells. This protein is part of a larger complex that utilizes ATP to alter the structure of nucleosomes, thereby facilitating access to DNA for various cellular processes. Research on INO80E has gained momentum due to its involvement in essential biological pathways and its potential implications in cancer biology and other diseases. Abnormalities in chromatin remodeling, including those involving INO80E, have been linked to tumorigenesis, making it a significant target for understanding cancer progression and developing novel therapeutic strategies. Recent studies indicate that INO80E interacts with various signaling pathways and protein partners, suggesting that it may play a multifaceted role in cellular responses to stress and environmental changes. Investigating the biophysical properties and functional mechanisms of recombinant INO80E not only enhances our understanding of chromatin dynamics but also opens avenues for targeted drug design and gene therapy approaches. Overall, the study of INO80E holds promise for elucidating the intricate mechanisms governing chromatin remodeling and its implications in health and disease.
