Cat: PA2000-4350

Recombinant Human BSG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BSG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BSG;Basigin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35613

  • Expression Region

    138-323aa

  • AA Sequence

    EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

  • Molecular Weight

    49.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of BSG (Basigin, or CD147) recombinant proteins has gained significant attention in recent years due to its crucial role in various biological processes and disease pathologies. BSG is a transmembrane glycoprotein belonging to the immunoglobulin superfamily, known for its involvement in cell adhesion, intercellular signaling, and interactions with various ligands, such as cyclophilins and MCT (monocarboxylate transporters). Research has shown that BSG is upregulated in several cancers, including breast, lung, and colorectal cancers, where it contributes to tumor progression, metastasis, and immune evasion. Additionally, BSG plays a vital role in the development of the central nervous system and is implicated in inflammatory responses and autoimmune diseases. The generation of recombinant BSG proteins has allowed scientists to investigate its functional properties and interactions at a molecular level. These studies facilitate the understanding of BSG's role in physiological and pathological conditions, potentially leading to targeted therapeutic strategies. Furthermore, recombinant BSG proteins serve as valuable tools in the development of diagnostics and vaccines, enhancing our knowledge of immune responses and pathogen interactions. Overall, the exploration of BSG recombinant proteins represents a promising avenue for advancing our understanding of fundamental biological processes and developing novel therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US