Cat: IPD-X12454

Recombinant Rhesus Macaque Ephrin-A5/EFNA5 Protein(HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ephrin-A5/EFNA5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Rhesus Macaque EFNA5 at 10 μg/mL (100 μL/well) can bind Mouse EPHA3. The ED50 for this effect is 146.7 ng/mL. Immobilized Rhesus Macaque EFNA5 at 10 μg/mlL (100 μL/well) can bind Mouse EPHA3. The ED50 for this effect is 146.7 ng/mL.

  • Alternative Names

    Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    F7GZC7

  • Expression Region

    Q21-N203

  • AA Sequence

    QDPGSKTVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

  • Protein Length

    Partial

  • Molecular Weight

    27 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ephrin-A5, encoded by the EFNA5 gene, is a member of the ephrin family, which are important signaling molecules in the nervous system and other tissues. Ephrin-A5 interacts with Eph receptors, playing a crucial role in various biological processes, including cell adhesion, migration, and boundary formation during neural development. Research has shown that ephrin-A5 is significantly involved in axon guidance and neuronal patterning, impacting synaptic plasticity and connectivity. Furthermore, aberrant expression of ephrin-A5 has been linked to pathological conditions such as cancer and neurological disorders. The development of recombinant ephrin-A5 protein has facilitated studies aiming to elucidate its roles in cellular signaling pathways and to explore its therapeutic potential. By generating and characterizing this protein, researchers can investigate the mechanisms underlying ephrin-Eph receptor interactions, assess their impact on neurodevelopment, and explore novel strategies for treating diseases where these pathways are dysregulated. Understanding the functions and interactions of ephrin-A5 at a molecular level is crucial for advancing both basic neuroscience and translational research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US