Analytical Data
-
Gene name
IRGM
- Application
-
Alternative Names
IRGM;IFI1;IRGM1;LRG47;Immunity-related GTPase family M Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1A4Y4
-
Expression Region
23-181aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKETLKIVSRTPVNITMAGDSGNGMSTFIS ALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTL ENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMD LSTGALPEVQLLQIRENVLENLQKERVCEY
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IRGM (Immunity-related GTPase M) is a gene that plays a crucial role in the immune response, particularly in the context of autophagy and pathogen resistance. Research has shown that IRGM is involved in the regulation of the innate immune system, helping to control infections by intracellular pathogens such as Mycobacterium tuberculosis and various viruses. Its significance is underscored by its association with several autoimmune and inflammatory diseases, making it a focal point for studying immune mechanisms. The interest in recombinant IRGM proteins has grown due to their potential applications in therapeutics and vaccine development. By producing and studying recombinant forms of IRGM, researchers aim to uncover the molecular pathways it regulates, particularly its GTPase activity, and how it mediates cellular responses to infection. This research could lead to novel strategies for enhancing immune responses or developing targeted therapies for diseases where the immune system is dysregulated. Additionally, understanding IRGM's functional domains and their interactions with other cellular components could provide insights into its role in autophagy and immune signaling. Overall, the study of IRGM recombinant proteins is not only vital for elucidating its fundamental biological roles but also for addressing clinical challenges associated with infectious diseases and immune disorders.
