Analytical Data
-
Gene name
CRYbB2
- Application
-
Alternative Names
CRYbB2；CRYB2；CRYB2A；Beta-crystallin B2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43320
-
Expression Region
1-205aa
-
AA Sequence
MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN
-
Molecular Weight
23.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRYbB2, a member of the cryopyrin/Pyrin family of proteins, is an intriguing target of research due to its essential role in regulating innate immune responses and maintaining cellular homeostasis. This protein functions primarily as a regulator of the NLRP3 inflammasome, a crucial component of the immune system that activates the production of pro-inflammatory cytokines in response to various pathogens and stress stimuli. Dysregulation of CRYbB2 has been implicated in several autoimmune and inflammatory diseases, making it a potential therapeutic target. Recent studies have focused on recombinant forms of CRYbB2 to elucidate its structural and functional properties, facilitating a deeper understanding of its mechanisms in immune modulation. By producing CRYbB2 in a recombinant manner, researchers aim to explore its interactions with other cellular components and identify novel pathways involved in inflammation and immune responses. The research surrounding CRYbB2 is essential not only for the advancement of immunology but also for developing innovative strategies to combat diseases characterized by inappropriate immune activation. Understanding the precise molecular mechanisms by which CRYbB2 influences inflammatory pathways could pave the way for targeted therapies and improve the management of related health conditions.
