Analytical Data
-
Gene name
GRa
- Application
-
Alternative Names
GRa；Glycine receptor subunit alpha-1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13403
-
Expression Region
25-190aa
-
AA Sequence
AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE
-
Molecular Weight
19.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRa, a recombinant protein derived from specific genetic sequences, has garnered significant attention in the fields of molecular biology and biotechnology. Its study is primarily motivated by the potential applications in therapeutic development, vaccine formulation, and the understanding of cellular mechanisms. Recombinant proteins like GRa are engineered using techniques such as recombinant DNA technology, allowing for the production of proteins that mimic natural counterparts or exhibit enhanced properties. The production of GRa in host systems, such as bacteria or yeast, facilitates large-scale availability and cost-effectiveness. Furthermore, research on GRa focuses on its structural and functional characterization, providing insights into its biological activity and interactions with other biomolecules. Investigations into its immunogenicity and stability are crucial for applications in drug design and vaccine development. As the understanding of GRa expands, it holds promise for novel treatment strategies for various diseases, making it an integral subject of study in contemporary biomedical research. This research not only advances fundamental scientific knowledge but also paves the way for innovative therapeutic interventions.
