Cat: IPD-X12471

Recombinant Others EFNB2A Protein(HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EFNB2A

  • 简介

    The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized zebrafish EFNB2A at 10 µg/mL (100 µL/well) can bind Biotinylated human EphB4. The ED50 for this effect is 31.44 ng/mL. Immobilized zebrafish EFNB2A at 10 µg/mL (100 µL/well) can bind Biotinylated human EphB4. The ED50 for this effect is 31.44 ng/mL.

  • Alternative Names

    Ephrin-B2a; efnb2

  • Species

    Others

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    O73874

  • Expression Region

    L25-A222

  • AA Sequence

    LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    30-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of EFNB2A, a member of the ephrin family, has garnered significant attention in the fields of neurobiology and cancer research due to its crucial roles in cell signaling, development, and tissue patterning. Ephrins are glycoproteins that interact with ephrin receptors to mediate various biological processes, including neuronal development, angiogenesis, and immune responses. EFNB2A, specifically, has been implicated in the regulation of neuronal axon guidance and synaptic plasticity, making it a key player in brain development and function. Moreover, emerging evidence suggests that aberrations in EFNB2A signaling pathways may contribute to tumorigenesis and metastasis in various cancers, indicating its potential as a therapeutic target. Researchers are particularly interested in the recombinant expression of EFNB2A to elucidate its functional properties and interactions with receptors, which could lead to advanced understanding of its roles in health and disease. Through detailed studies of EFNB2A, scientists aim to uncover its potential applications in regenerative medicine and cancer treatment, paving the way for novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US