Analytical Data
-
Gene name
KIAA1510
- Application
-
Alternative Names
COL20A1. KIAA1510
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P218
-
Expression Region
1-155aa
-
AA Sequence
MRGLEGTAGLPGPPGPRGFQGMAGARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQLVSQACESAIQTHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGRGEPGAVGQMGSPGQQGASTQGLWE
-
Molecular Weight
42.79 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA1510, also known as KIF7, is a gene that encodes a member of the kinesin superfamily of motor proteins, specifically involved in cellular processes such as mitosis and cilia function. Research into KIAA1510 has garnered interest due to its significant role in the regulation of primary cilia, which are essential for various signaling pathways, including Hedgehog signaling. Aberrations in KIAA1510 have been associated with multiple developmental disorders and diseases, particularly those affecting cilia function. Thus, studying the recombinant protein of KIAA1510 is crucial for understanding its molecular mechanisms and potential implications in ciliopathies and related conditions. Efforts to produce and characterize the recombinant KIAA1510 protein have aimed to elucidate its interaction with other cellular components and its functional pathways, contributing to the broader understanding of kinesin proteins in cellular dynamics. Furthermore, insights gained from this research may pave the way for novel therapeutic strategies targeting ciliopathies and provide a foundation for future studies on the genetic and cellular basis of related diseases. As the field continues to evolve, the exploration of KIAA1510 and its recombinant forms holds promise for advancing our comprehension of cilia biology and its clinical significance.
