Analytical Data
-
Gene name
AP3B2
- Application
-
Alternative Names
AP3B2；AP-3 complex subunit beta-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13367
-
Expression Region
973-1078aa
-
AA Sequence
APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ
-
Molecular Weight
19.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AP3B2, a subunit of the adaptor protein complex 3 (AP-3), plays a crucial role in intracellular trafficking, specifically in the sorting of lysosomal and melanosomal proteins. The AP-3 complex is essential for the transport of cargo proteins from the trans-Golgi network to the endosomes and lysosomes, a process vital for maintaining cellular homeostasis. Mutations in the AP3B2 gene have been implicated in various genetic disorders, such as Hermansky-Pudlak syndrome, which is characterized by oculocutaneous albinism and bleeding disorders due to defective lysosomal trafficking. Research on AP3B2 recombinant proteins has garnered attention for potential therapeutic interventions and a deeper understanding of its biological functions. By producing and characterizing AP3B2 recombinant proteins, scientists aim to elucidate the molecular mechanisms underlying its role in cellular processes and the pathological effects of its dysfunction. This research not only enhances our comprehension of intracellular trafficking pathways but also opens avenues for developing targeted therapies for diseases associated with AP3B2 mutations, thereby contributing to translational medicine.
