Analytical Data
-
Gene name
C1s1
- Application
-
Alternative Names
C1s1；Complement C1s subcomponent
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8CG14
-
Expression Region
16-688aa
-
AA Sequence
EPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYFTHVDIEPSESCAYDSVQIISGGIEEGRLCGQKTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNCPDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISCAKKITANSTWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKCQPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQLGIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD
-
Molecular Weight
77.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1s1 is a serine protease that plays a critical role in the classical complement pathway, which is an essential component of the immune system. It is involved in the activation of complement proteins, leading to the opsonization of pathogens, inflammation, and cell lysis. The study of C1s1 recombinant protein has gained significant attention due to its potential applications in therapeutic development and diagnostic tools. Understanding the structure and function of C1s1 can provide insights into the regulation of the complement system, which is crucial for maintaining immune homeostasis. Furthermore, dysregulation of this pathway has been linked to various autoimmune diseases and infections, highlighting the importance of establishing effective interventions. Researchers have focused on generating recombinant C1s1 proteins to facilitate detailed biochemical studies and to explore their interactions with other complement components. Advances in recombinant DNA technology enable the production of this protein in sufficient quantities, allowing for high-throughput screening and characterization. By elucidating the mechanisms of C1s1 activity and its interactions within the complement cascade, scientists aim to identify novel therapeutic targets that could potentially mitigate the effects of complement-mediated diseases. Additionally, the availability of purified C1s1 can aid in developing vaccines or antibodies that modulate the immune response. Overall, the research on C1s1 recombinant protein is crucial for enhancing our understanding of immune responses and for advancing therapeutic options in complement-related disorders.
