Analytical Data
-
Gene name
LTbR
- Application
-
Alternative Names
TRAF3;CAP-1;CRAF1;TRAFAMN;TNF receptor-associated factor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36941
-
Expression Region
31-227aa
-
AA Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVC ATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGM FCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMVDH HHHHH
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The LTbR (lymphotoxin beta receptor) is a crucial component in the immune system, playing a significant role in the development and maintenance of secondary lymphoid organs, including lymph nodes and spleen. LTbR is a member of the tumor necrosis factor (TNF) receptor superfamily and is primarily activated by its ligand, lymphotoxin-alpha (LTα). This interaction is essential for mediating various immune responses, including lymphocyte trafficking, survival, and differentiation. Research into LTbR recombinant proteins has gained traction due to their potential therapeutic applications in autoimmune diseases, infectious diseases, and cancer. Understanding the structure and function of LTbR is vital for unraveling its signaling pathways and identifying how it influences immune cell behavior. Consequently, recombinant LTbR proteins are being developed for use as research tools to dissect these complex immunological processes and as potential candidates for therapeutic interventions, paving the way for novel strategies in immunotherapy and vaccine development. Moreover, the manipulation of LTbR signaling pathways could provide insights into enhancing immune responses or inhibiting undesirable inflammation, making it a promising target in modern immunological research.
