Analytical Data
-
Gene name
KDM6A
- Application
-
Alternative Names
KDM6A；UTX；Lysine-specific demethylase 6A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15550
-
Expression Region
1095-1258aa
-
AA Sequence
KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW
-
Molecular Weight
26.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KDM6A (Lysine Demethylase 6A) is a member of the KDM6 family of histone demethylases, which play a crucial role in epigenetic regulation by removing methyl groups from histone lysine residues. This action can lead to the activation or repression of gene expression, impacting various biological processes including development, differentiation, and cell identity. Recent studies have highlighted the importance of KDM6A in various diseases, particularly in cancer, where mutations or dysregulation of this protein have been implicated in tumorigenesis and poor prognosis. The enzyme primarily removes methylation marks from histone H3 at lysine 27, a modification often associated with gene silencing. Investigating KDM6A has gained significance as it has shown potential as a therapeutic target, with compounds developed to inhibit its demethylase activity at the forefront of cancer research. Moreover, KDM6A is involved in processes such as stem cell maintenance and immune response, making it a critical protein for understanding both normal biological functions and pathological conditions. The study of KDM6A and its recombinant forms is essential for elucidating its mechanisms of action and discovering novel therapeutic strategies to combat diseases linked to its dysfunction. This background sets the stage for further exploration of KDM6A in basic research and clinical applications, ultimately aiming to enhance our understanding of epigenetic regulation in health and disease.
