Analytical Data
-
Gene name
HUWE1
- Application
-
Alternative Names
HUWE1；KIAA0312；KIAA1578；UREB1；E3 ubiquitin-Protein ligase HUWE1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z6Z7
-
Expression Region
4005-4374aa
-
AA Sequence
LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
-
Molecular Weight
50.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HUWE1, also known as HECT, UBA, and WWE domain containing 1, is an essential E3 ubiquitin ligase that plays a significant role in protein regulation through ubiquitination. Research on HUWE1 has garnered attention due to its involvement in various cellular processes, including cell cycle regulation, apoptosis, and DNA damage response. Dysregulation of HUWE1 has been linked to several diseases, particularly cancer, where aberrant expression or mutations can disrupt normal cellular homeostasis. Studies have shown that HUWE1 can target key regulatory proteins for ubiquitination, leading to their degradation and thus influencing cell proliferation and survival. The investigation of HUWE1's mechanisms and interactions with other cellular components is crucial for understanding its role in tumorigenesis and may provide insights into potential therapeutic strategies. Given the complexity of the ubiquitin-proteasome system and HUWE1's diverse functions, ongoing research aims to elucidate its precise biological functions and the potential implications of targeting HUWE1 in disease treatment. Understanding HUWE1's structure, function, and regulatory pathways continues to be a pivotal area of research in molecular biology, with the potential for novel interventions in cancer therapy and other diseases associated with its dysregulation. This makes the study of HUWE1 recombinant proteins not only critical for basic science but also for the development of targeted therapies that exploit its roles in cellular regulation.
