Analytical Data
-
Gene name
MDP1
- Application
-
Alternative Names
DPEP1;MDP;RDP;Dipeptidase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86V88
-
Expression Region
1-176aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVD PPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEG ANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERR NIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MDP1 (Myelin Differentiation Protein 1) is a crucial protein involved in the formation and maintenance of myelin, the protective sheath surrounding nerve fibers, which is essential for proper neuronal function and signal transmission. Abnormalities in myelination processes are associated with various neurological disorders, including multiple sclerosis and leukodystrophies. The study of MDP1 and its recombinant proteins has gained significant interest in recent years due to its potential therapeutic implications. Researchers aim to understand the structure-function relationship of MDP1, its role in oligodendrocyte development, and the signaling pathways it influences. Additionally, recombinant MDP1 can be utilized in experimental models to investigate myelination and demyelination mechanisms, providing insights into potential regenerative therapies for nervous system injuries. Current studies are focusing on optimizing the production and characterization of MDP1 recombinant proteins to facilitate their use in both basic research and clinical applications. By elucidating the biochemical properties and interactions of MDP1, scientists hope to identify novel targets for therapeutic intervention in demyelinating diseases, ultimately leading to the development of effective treatments that can enhance myelin repair and improve neurological outcomes.
