Cat: PA2000-465DB

Recombinant Human TPOR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TPOR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TPOR;TPOR;Thrombopoietin receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P40238

  • Expression Region

    22-353aa

  • AA Sequence

    QVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYPR EKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRT QRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRY GPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDG PKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGS WSLPVTVDLPGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRAR CCPRDRYPIWENCEEEEKTNPGLQTPQFSRCH

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TPOR (Thrombopoietin receptor) is a crucial component in the regulation of megakaryocyte differentiation and platelet production. As a primary receptor for thrombopoietin, it plays a significant role in hematopoiesis and maintaining platelet homeostasis. Dysregulation of TPOR has been implicated in various hematological disorders, including thrombocytopenia and essential thrombocythemia. Recent studies have aimed to characterize TPOR at the molecular level, focusing on its structure and function to understand the mechanisms that govern its activity. The development of TPOR recombinant proteins has provided valuable tools for both basic research and therapeutic applications, allowing scientists to explore its signaling pathways and interactions with other cellular components. Furthermore, engineered TPOR variants are being investigated for their potential in treating disorders related to platelet production. By enhancing our understanding of TPOR and its role in platelet biology, researchers hope to pave the way for innovative treatments for blood-related diseases, making it a pivotal area of study in molecular and cellular biology. The insights gained from TPOR research hold promise for advancing therapeutic strategies targeting platelet disorders and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US