Analytical Data
-
Gene name
KRTAP4-12
- Application
-
Alternative Names
KRTAP4-12; KAP4.12; KRTAP4.12Keratin-associated protein 4-12; Keratin-associated protein 4.12; Ultrahigh sulfur keratin-associated protein 4.12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ66
-
Expression Region
1-201aa
-
AA Sequence
MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSSCCPSCCESSCCRPCCCLRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC
-
Molecular Weight
48.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP4-12, a member of the keratin-associated protein (KRTAP) family, has garnered attention in the field of molecular biology and genetics due to its potential role in hair follicle structure and function. These proteins, characterized by their unique structure and expression patterns, are believed to be crucial in the formation of the hair shaft, influencing properties such as texture and resilience. Research indicates that KRTAP4-12 is primarily expressed in specific hair follicle cell types, suggesting its importance in keratinization and hair development processes. The understanding of KRTAP4-12, particularly in the context of various hair defects and disorders, has implications for both basic research and clinical applications, including potential therapeutic strategies for hair loss and other dermatological conditions. Studies have explored its genetic regulation and interactions with other keratin and keratin-associated proteins, revealing complex pathways that govern hair follicle biology. Advancements in genetic sequencing and molecular techniques have facilitated the exploration of KRTAP4-12’s functional roles, emphasizing its significance in unraveling the genetic basis of hair phenotypes. As such, ongoing research aims to elucidate the mechanisms by which KRTAP4-12 contributes to hair morphology and integrity, paving the way for integrative approaches in hair biology and potential treatments for hair-related disorders.
