Analytical Data
-
Gene name
TDO
- Application
-
Alternative Names
TDO;TDO;Tryptophan 2.3-dioxygenase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48775
-
Expression Region
1-406aa
-
AA Sequence
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK VLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNG HVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPA SGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKT LLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEK EEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYF SSDESD
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TDO (Tryptophan 2,3-dioxygenase) is an essential enzyme involved in the catabolism of tryptophan, an amino acid that serves as a precursor for several important biomolecules, including serotonin and melatonin. The research on TDO has gained significant attention due to its role in various physiological processes and its implication in numerous diseases, such as cancer, depression, and neurodegenerative disorders. TDO catalyzes the oxidative cleavage of tryptophan into N-formylkynurenine, marking the first step in the kynurenine pathway, which is crucial for regulating immune responses and neuronal health. Abnormal TDO activity is associated with the dysregulation of tryptophan metabolism, leading to altered levels of neuroactive metabolites that can affect mood and cognitive function. Furthermore, the modulation of TDO has emerged as a potential therapeutic target, particularly in oncology, where tumors can exploit tryptophan catabolism to evade immune surveillance. Understanding the structure and function of recombinant TDO proteins enables researchers to develop specific inhibitors and therapeutic strategies aimed at restoring normal metabolic pathways. Additionally, advancements in protein engineering techniques facilitate the production of modified TDO variants with altered catalytic properties, contributing to our knowledge of enzyme function and its implications in health and disease. Consequently, the exploration of TDO not only enhances our understanding of tryptophan metabolism but also opens new avenues for the development of targeted therapies for diverse clinical conditions.











