Analytical Data
-
Gene name
MLLT11
- Application
-
Alternative Names
MLLT11;AF1Q;Protein AF1q
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13015
-
Expression Region
2-90aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHENLYFQGEFRDPVSSQYSSFLFWRMPIPELD LSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFN FWRAPIASIHSFELDLL
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MLLT11 is a gene that encodes a protein involved in various cellular processes, particularly in hematopoiesis and oncogenesis. It is known to play a role in gene regulation as part of the MLL (Mixed-Lineage Leukemia) fusion proteins. The MLL gene rearrangements are commonly associated with aggressive forms of leukemia, paving the way for research into MLLT11's function and its potential implications in cancer biology. Understanding MLLT11's structure and its molecular interactions can provide insights into its role in leukemogenesis and may reveal therapeutic targets for treating leukemia. Additionally, MLLT11's participation in chromatin remodeling and transcriptional regulation highlights its importance in normal cellular differentiation and development. Given the complexity of MLLT11 fusion proteins and their involvement in various malignancies, unraveling the molecular mechanisms by which MLLT11 contributes to disease progression is critical for the development of innovative diagnostic and therapeutic strategies in oncology. This research not only enhances our understanding of hematological disorders but also the fundamental processes of gene expression regulation.
