Cat: PA1000-1982

Recombinant Human MMP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP1;CLG;Interstitial collagenase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P03956

  • Expression Region

    20-469aa

  • AA Sequence

    FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQE FFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIE NYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHR DNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHE LGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP IGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISV FWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFG FPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDF PGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN HHHHHHHHHH

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MMP1, or Matrix Metalloproteinase-1, is a crucial enzyme involved in the degradation of the extracellular matrix, playing a significant role in tissue remodeling and repair processes. Its study has garnered attention due to its implications in various physiological and pathological conditions, including wound healing, inflammation, and cancer metastasis. MMP1 is responsible for the cleavage of collagen, particularly type I collagen, which is a fundamental component of the extracellular matrix in connective tissues. Dysregulation of MMP1 activity has been linked to the progression of several diseases, including rheumatoid arthritis and various forms of cancer where it facilitates tumor invasion and metastasis. Researchers have been focused on developing recombinant MMP1 protein for various applications, including the investigation of its biochemical properties, functional roles in cellular processes, and potential therapeutic interventions. The recombinant protein allows for detailed studies on enzyme kinetics, inhibitor design, and the development of specific MMP1 antagonists. Understanding the structure-function relationship of MMP1 can enable the identification of novel therapeutic targets and strategies for diseases characterized by aberrant matrix remodeling. Additionally, MMP1 serves as a model for studying the broader family of matrix metalloproteinases, contributing to the understanding of their diverse roles in health and disease. This research area holds promise for developing innovative treatments that can manipulate MMP1 activity to improve tissue repair, combat cancer spread, and manage other disorders associated with extracellular matrix dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US