Analytical Data
-
Gene name
LASS1
- Application
-
Alternative Names
CERS1; LAG1; LASS1; UOG1; Ceramide synthase 1; CerS1; LAG1 longevity assurance homolog 1; Longevity assurance gene 1 protein homolog 1; Protein UOG-1; Sphingoid base N-stearoyltransferase CERS1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27544
-
Expression Region
1-239aa
-
AA Sequence
MPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFLYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAE
-
Molecular Weight
54.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LASS1 (Longevity Assurance Homolog 1) is a crucial enzyme belonging to the Longevity Assurance gene family, primarily involved in sphingolipid metabolism. It catalyzes the synthesis of sphinganine, a precursor for various bioactive sphingolipids that play pivotal roles in cellular processes such as proliferation, apoptosis, and differentiation. Research has indicated that LASS1 may be implicated in several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. Additionally, its function in regulating lipid metabolism suggests a significant role in metabolic diseases and aging. Given these diverse biological functions, the study of LASS1 recombinant proteins is essential for understanding its mechanistic roles in lipid signaling pathways and disease progression. By generating and characterizing LASS1 recombinant proteins, researchers aim to elucidate its structural properties, enzymatic activity, and interaction with other cellular components. This knowledge can pave the way for developing novel strategies in disease intervention, making LASS1 an attractive candidate for further biochemical and pharmacological exploration.











