Analytical Data
-
Gene name
LCE1D
- Application
-
Alternative Names
LCE1D; LEP4Late cornified envelope protein 1D; Late envelope protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T752
-
Expression Region
1-114aa
-
AA Sequence
MSCQQSQQQCQPPPKCTPKCTPKCPAPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCGSNSGGCCSSGGGGCCLSHHRRHRSHRRRPQSSDCCSQPSGGSSCCGGGSSQHSGGCC
-
Molecular Weight
12.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE1D, a member of the late cornified envelope (LCE) family of proteins, is primarily expressed in the epidermis and plays a crucial role in skin barrier function and the regulation of keratinocyte differentiation. Research on LCE1D has gained interest due to its potential involvement in various dermatological conditions and its association with skin diseases such as psoriasis and atopic dermatitis. The protein is hypothesized to contribute to the structural integrity and water retention of the skin, which are essential for maintaining overall skin health. Advances in proteomics and genomics have allowed for a more in-depth understanding of LCE1D's expression patterns and regulatory mechanisms. Studies indicate that LCE1D may participate in inflammatory responses and cellular signaling pathways that govern keratinocyte behavior. Additionally, given the rising incidence of skin-related disorders, exploring LCE1D's functional role could lead to novel therapeutic strategies for enhancing skin repair and barrier recovery. Understanding the precise mechanisms of LCE1D function and regulation may also provide insights into the development of targeted treatments for skin pathologies, making it an important focal point for ongoing research in dermatology and molecular medicine.
