Analytical Data
-
Gene name
phoQ
- Application
-
Alternative Names
phoQ；Sensor Protein PhoQ
-
Species
Salmonella
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DM80
-
Expression Region
215-487aa
-
AA Sequence
WWSLRPIEALAREVRELEDHHREMLNPETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSVSKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPGIPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQHPTQKEE
-
Molecular Weight
38.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PhoQ is a key component of a two-component regulatory system that plays a critical role in the response of bacteria to environmental stimuli, particularly in the regulation of virulence and antibiotic resistance. This system is prevalent in many pathogenic bacteria, including Salmonella and Escherichia coli. The PhoQ protein, a sensor kinase, detects various signals such as magnesium ion concentration and other environmental changes, leading to the phosphorylation of its partner response regulator, PhoP. The PhoQ/PhoP system modulates the expression of genes involved in critical processes like stress response, biofilm formation, and immune evasion. Research into the recombinant expression of PhoQ is essential for understanding its structure, function, and interactions at a molecular level. By producing and purifying PhoQ as a recombinant protein, researchers aim to elucidate its signaling mechanisms and identify potential inhibitors that could serve as novel therapeutic agents against bacterial infections. Given the rising threat of antibiotic resistance, investigating PhoQ and its regulatory pathways may provide new insights into the development of targeted treatments and strategies to combat persistent bacterial pathogens.
