Analytical Data
-
Gene name
NR0B2
- Application
-
Alternative Names
NR0B2；SHP；Nuclear receptor subfamily 0 group B member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15466
-
Expression Region
1-257aa
-
AA Sequence
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLC APHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGL AQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQ CCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLC EVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLL GDMLLLR
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NR0B2, also known as DAX-1 (Dosage Sensitive Sex Reversal Anomaly-1), is a member of the nuclear receptor superfamily, which plays a crucial role in various biological processes, including endocrine function and sexual differentiation. Research into NR0B2 has gained importance due to its involvement in the development of the adrenal glands and gonads, as well as its implications in disorders of sex development (DSDs) and adrenal insufficiency. NR0B2 functions as a transcriptional regulator and is known to exhibit antagonistic activity against other nuclear receptors, thereby modulating hormonal signals and cellular responses. Mutations or alterations in NR0B2 expression can lead to significant clinical conditions, necessitating a deeper understanding of its molecular mechanisms. The generation of NR0B2 recombinant proteins enables researchers to elucidate its structure-function relationships, interaction with other nuclear receptors, and regulatory pathways. This research not only enhances our understanding of fundamental biological processes but also holds potential for developing therapeutic strategies for conditions linked to NR0B2 dysregulation. Additionally, studying NR0B2's role in pathophysiology can inform approaches for personalized medicine in treating related endocrine disorders, making it a vital focus in both basic and translational research.
