Analytical Data
-
Gene name
ZDHHC5
- Application
-
Alternative Names
ZDHHC5；KIAA1748；ZNF375；Palmitoyltransferase ZDHHC5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9C0B5
-
Expression Region
60-148aa
-
AA Sequence
ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY
-
Molecular Weight
12.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC5 (Zinc Finger DHHC-Type Containing 5) is a highly conserved protein that plays a crucial role in the palmitoylation of various substrates, a post-translational modification process that adds palmitic acid, thereby influencing protein localization, stability, and function. Recent studies have highlighted the importance of ZDHHC5 in neuronal development and synaptic function, suggesting its involvement in cognitive processes and neurodegenerative diseases. Its dysregulation has been linked to disorders such as schizophrenia and autism spectrum disorders, emphasizing the need for further research into its mechanisms of action. The expression and activity of ZDHHC5 are regulated by various signaling pathways, making it a potential therapeutic target. Understanding its functional dynamics could provide insights into the molecular basis of related diseases and pave the way for novel treatments. The recombinant production of ZDHHC5 offers a valuable tool for studying its biochemical properties and interactions, facilitating the exploration of its roles in cellular physiology and pathology. As the demand for elucidating the mechanistic underpinnings of palmitoylation increases, ZDHHC5 stands out as a significant focus of research within the broader context of neurobiology and cellular signal transduction.
