Analytical Data
-
Gene name
NAPG
- Application
-
Alternative Names
NAPG;SNAPG;Gamma-soluble NSF attachment Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99747
-
Expression Region
1-312aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAAQKINEGLEHLAKAEKYLKTGFLK WKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAK AYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIE NVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALS IQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGF NGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVP GGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAPG, or N-Acetylated Peptide Glycan, is a type of recombinant protein that has garnered increasing attention in the field of biotechnology and pharmaceuticals due to its potential applications in drug delivery, diagnostics, and therapeutics. The structural complexity and bioactivity of glycoproteins, including NAPG, make them critical in various biological processes, such as cell signaling and immune responses. Understanding the mechanisms behind glycosylation—the process by which sugars are added to proteins—has significant implications for creating more effective biologics. Researchers have been focused on the recombinant expression of NAPG to achieve high yields and functional activity. Advances in recombinant DNA technology, coupled with increased understanding of post-translational modifications, allow for the optimization of NAPG production in suitable host systems, such as yeast or mammalian cells. The study of NAPG also extends to its therapeutic uses, particularly in the development of vaccines and targeted therapies that leverage its glycan structures to enhance specificity and immune recognition. Furthermore, as the demand for novel biopharmaceuticals continues to rise, the exploration of NAPG serves as a promising avenue for innovative drug designs and improved treatment efficacy, making it a focal point in contemporary research initiatives aimed at addressing unmet medical needs.











