Cat: PA1000-2088

Recombinant Human NAPG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NAPG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NAPG;SNAPG;Gamma-soluble NSF attachment Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99747

  • Expression Region

    1-312aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMAAQKINEGLEHLAKAEKYLKTGFLK WKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAK AYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIE NVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALS IQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGF NGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVP GGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NAPG, or N-Acetylated Peptide Glycan, is a type of recombinant protein that has garnered increasing attention in the field of biotechnology and pharmaceuticals due to its potential applications in drug delivery, diagnostics, and therapeutics. The structural complexity and bioactivity of glycoproteins, including NAPG, make them critical in various biological processes, such as cell signaling and immune responses. Understanding the mechanisms behind glycosylation—the process by which sugars are added to proteins—has significant implications for creating more effective biologics. Researchers have been focused on the recombinant expression of NAPG to achieve high yields and functional activity. Advances in recombinant DNA technology, coupled with increased understanding of post-translational modifications, allow for the optimization of NAPG production in suitable host systems, such as yeast or mammalian cells. The study of NAPG also extends to its therapeutic uses, particularly in the development of vaccines and targeted therapies that leverage its glycan structures to enhance specificity and immune recognition. Furthermore, as the demand for novel biopharmaceuticals continues to rise, the exploration of NAPG serves as a promising avenue for innovative drug designs and improved treatment efficacy, making it a focal point in contemporary research initiatives aimed at addressing unmet medical needs.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US