Analytical Data
-
Gene name
ITGAM
- Application
-
Alternative Names
ITGAM；CD11B；CR3A；Integrin alpha-M
-
Species
Human
-
Source
E. coli
-
Tag
6xHis-GST tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11215
-
Expression Region
46-150aa
-
AA Sequence
VLFQGPLGSPEFRTVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHL
-
Molecular Weight
57.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGAM, or integrin alpha M, also known as CD11b, is a cell surface receptor primarily expressed on myeloid cells, playing a crucial role in immune response by mediating adhesion, phagocytosis, and the activation of leukocytes. The study of ITGAM recombinant proteins has garnered attention due to its involvement in various pathological conditions, including autoimmune diseases, cancer, and infectious diseases. Research indicates that polymorphisms in the ITGAM gene are linked to increased susceptibility to diseases such as systemic lupus erythematosus (SLE), highlighting its potential as a therapeutic target. The recombinant version of this protein is pivotal for studying its functional properties, understanding its role in cell signaling and adhesion processes, and exploring its implications in disease mechanisms. By producing ITGAM as a recombinant protein, scientists can develop antibodies for diagnostic purposes, investigate the receptor's interactions with ligands, and test potential inhibitory compounds. This research is critical for elucidating the molecular pathways involving ITGAM, paving the way for innovative treatment strategies and improving our understanding of immune-related disorders.
