Analytical Data
-
Gene name
LRRC29
- Application
-
Alternative Names
F box and leucine rich repeat protein 9 ; F box/LRR repeat protein 9 ; F-box and leucine-rich repeat protein 9; F-box protein FBL9; F-box/LRR-repeat protein 9; FBL9 ; FBXL9 ; Leucine rich repeat containing protein 29; Leucine-rich repeat-containing protein 29; LRC29_HUMAN; LRRC29
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WV35
-
Expression Region
1-233aa
-
AA Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC29 (Leucine-rich repeat-containing protein 29) is a member of the leucine-rich repeat (LRR) protein family, which is characterized by a series of LRR motifs involved in protein-protein interactions and signaling pathways. Previous studies have implicated LRRC29 in various physiological processes, including cell signaling, immune responses, and development. Notably, it has been associated with certain diseases, particularly in the context of cancer, where its expression levels can influence tumor progression and metastasis. The precise functional roles of LRRC29, however, remain largely undefined. Therefore, the recombinant expression and characterization of LRRC29 have garnered attention as researchers aim to elucidate its structural properties and biological functions. By producing recombinant LRRC29, scientists can investigate its interactions with other cellular proteins and its downstream effects on signaling pathways. Understanding the biology of LRRC29 may reveal potential therapeutic targets for diseases where this protein is implicated. Moreover, the study of this protein could contribute to a broader understanding of LRR proteins in general, which play crucial roles in various cellular processes. Continued research into LRRC29's mechanisms may lead to novel insights into its role in health and disease, fostering advancements in targeted therapies and personalized medicine.
