Cat: PA1000-2142

Recombinant Human NFKBID Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NFKBID

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NFKBID;IKBNS;NF-kappa-B inhibitor delta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NI38

  • Expression Region

    1-313aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMEAGPWRVSAPPSGPPQFPAVVPGPSL EVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRR LDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAAT YGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRV LSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLL ELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLR NLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NFKBID, or NF-kappaB inhibitor δ, is a member of the NF-kappaB inhibitory protein family, playing a crucial role in regulating immune responses and maintaining cellular homeostasis. Research into NFKBID has gained significance due to its involvement in various physiological processes and pathological conditions, including inflammation, cancer, and autoimmune diseases. The NF-kappaB signaling pathway is critical for cell survival, proliferation, and differentiation, and the regulation of this pathway by NFKBID is essential for preventing excessive activation that can lead to disease. Recent studies have highlighted the potential of NFKBID as a therapeutic target, with promising implications for developing interventions that manipulate the NF-kappaB pathway in disease contexts. Moreover, the recombinant expression of NFKBID facilitates detailed functional studies, allowing researchers to explore its molecular mechanisms and interactions with other signaling components. Understanding the structure and function of NFKBID is vital for deciphering its role in disease pathology and for identifying novel treatment strategies that could mitigate the adverse effects of dysregulated NF-kappaB activity. As researchers continue to investigate the implications of NFKBID in different biological contexts, the recombinant protein's study offers a pathway to uncover new insights into its function and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US