Cat: PA1000-2155

Recombinant Human Nkx3-1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Nkx3-1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NKX3-1;NKX3.1;NKX3A;Homeobox Protein Nkx-3.1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99801

  • Expression Region

    1-234aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMLRVPEPRPGEAKAEGAAPPTPSKPLT SFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLS TGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRS RAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRY KTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVG SWSPAFW

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Nkx3-1 is a transcription factor belonging to the NKX family, primarily expressed in the prostate and is critical for prostate development and function. Its role extends beyond normal prostate physiology to the realm of cancer biology, particularly in prostate cancer. Loss of Nkx3-1 expression has been associated with tumorigenesis, making it a significant focus of research. Studies indicate that Nkx3-1 functions as a tumor suppressor, involved in regulating cell proliferation, apoptosis, and differentiation. The reconstitution of Nkx3-1 as a recombinant protein has been valuable for elucidating its molecular mechanisms and interactions within the signaling pathways pertinent to prostate cancer. By generating and characterizing Nkx3-1 recombinant proteins, researchers aim to explore its potential therapeutic applications and understand how mutations or altered expression levels contribute to cancer progression. Additionally, the insights gained from this research could lead to novel biomarkers for prostate cancer diagnosis and prognosis, enhancing the stratification of patients for tailored therapeutic strategies. Overall, the investigation of Nkx3-1 recombinant proteins represents a promising avenue in both basic and translational cancer research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US