Analytical Data
-
Gene name
Nkx3-1
- Application
-
Alternative Names
NKX3-1;NKX3.1;NKX3A;Homeobox Protein Nkx-3.1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99801
-
Expression Region
1-234aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLRVPEPRPGEAKAEGAAPPTPSKPLT SFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLS TGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRS RAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRY KTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVG SWSPAFW
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nkx3-1 is a transcription factor belonging to the NKX family, primarily expressed in the prostate and is critical for prostate development and function. Its role extends beyond normal prostate physiology to the realm of cancer biology, particularly in prostate cancer. Loss of Nkx3-1 expression has been associated with tumorigenesis, making it a significant focus of research. Studies indicate that Nkx3-1 functions as a tumor suppressor, involved in regulating cell proliferation, apoptosis, and differentiation. The reconstitution of Nkx3-1 as a recombinant protein has been valuable for elucidating its molecular mechanisms and interactions within the signaling pathways pertinent to prostate cancer. By generating and characterizing Nkx3-1 recombinant proteins, researchers aim to explore its potential therapeutic applications and understand how mutations or altered expression levels contribute to cancer progression. Additionally, the insights gained from this research could lead to novel biomarkers for prostate cancer diagnosis and prognosis, enhancing the stratification of patients for tailored therapeutic strategies. Overall, the investigation of Nkx3-1 recombinant proteins represents a promising avenue in both basic and translational cancer research.











