Analytical Data
-
Gene name
SFTA2
- Application
-
Alternative Names
SFTA2；COLEC5；PSAP；SFTP1；Pulmonary surfactant-associated Protein A2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UW10
-
Expression Region
20-78aa
-
AA Sequence
TGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARSQHHVVCNT
-
Molecular Weight
13.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFTA2, or Surfactant Protein A2, is a member of the surfactant protein family that plays a crucial role in pulmonary surfactant function, innate immunity, and the maintenance of alveolar integrity. Research has highlighted its importance in various lung diseases, including pulmonary fibrosis, chronic obstructive pulmonary disease (COPD), and neonatal respiratory distress syndrome. Due to its significant role in maintaining lung homeostasis, SFTA2 has emerged as a target for therapeutic strategies aimed at enhancing surfactant function and modulating immune responses in the lungs. The recombinant expression of SFTA2 proteins allows for the detailed study of their structure-function relationships and provides a platform for potential therapeutic applications. Advances in genetic engineering techniques have enabled the production of recombinant SFTA2 proteins, facilitating investigations into their molecular mechanisms and biological activities. Furthermore, understanding the protein's role in surfactant metabolism and immune response can lead to the development of novel interventions for lung pathologies, enhancing our ability to treat respiratory diseases effectively. Overall, the ongoing research surrounding recombinant SFTA2 proteins is pivotal for uncovering new therapies aimed at improving lung function and patient outcomes in respiratory conditions.
