Analytical Data
-
Gene name
NPM1
- Application
-
Alternative Names
NPM1;NPM;Nucleophosmin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06748
-
Expression Region
1-294aa
-
AA Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPM1 (Nucleophosmin 1) is a highly conserved nucleolus-associated protein that plays crucial roles in ribosome biogenesis, cell growth, and genomic stability. Its involvement in cancer, particularly acute myeloid leukemia (AML), has garnered significant attention, as mutations in the NPM1 gene are frequently observed in patients, leading to altered protein function and contributing to leukemogenesis. The most common mutation, NPM1c, results in the aberrant cytoplasmic localization of the protein, disrupting its normal nuclear functions. This altered localization is associated with poor prognosis, making NPM1 a critical biomarker for AML. Understanding the structural properties and functional mechanisms of NPM1 is essential for developing targeted therapies. The study of recombinant NPM1 proteins provides insights into the molecular pathways by which NPM1 mutations drive cancer development. Researchers have utilized various expression systems to produce recombinant NPM1 proteins, facilitating the exploration of their biochemical properties, interactions with other cellular components, and the effects of specific mutations. This research is vital not only for elucidating the pathophysiological roles of NPM1 in cancer but also for devising potential therapeutic strategies aimed at restoring normal NPM1 function or targeting its aberrant pathways in cancer treatment. Overall, NPM1 represents a significant focus in cancer research, bridging the gap between molecular biology and clinical applications in oncology.











