Analytical Data
-
Gene name
NUCB2
- Application
-
Alternative Names
NUCB2;NEFA;Nucleobindin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80303
-
Expression Region
25-106aa
-
AA Sequence
MKHHHHHHASVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDV LETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUCB2, or Nucleobindin-2, is a calcium-binding protein that plays a significant role in various physiological processes, including energy metabolism, neuroprotection, and regulation of appetite by functioning as a precursor to neuropeptide orexin. Research on NUCB2 has garnered attention due to its involvement in metabolic diseases, neurodegenerative disorders, and obesity. Evidence suggests that NUCB2 influences insulin secretion and glucose homeostasis, making it a potential target for therapeutic interventions in type 2 diabetes. Moreover, its neuroprotective properties indicate a promising role in combating conditions like Alzheimer's disease, where it may help mitigate neuronal damage. As NUCB2 is processed into biologically active peptides, the recombinant expression of NUCB2 protein has become pivotal in studies seeking to elucidate its structure-function relationships and therapeutic potential. Characterizing NUCB2 through recombinant protein techniques enables researchers to investigate its biological mechanisms in detail and explore its applications in drug development, particularly for conditions linked to metabolic dysregulation and neurodegeneration. The ongoing research into NUCB2 not only enhances our understanding of its cellular roles but also opens up new avenues for innovative treatments targeting metabolic and neurodegenerative diseases.
